Lineage for d1qwta_ (1qwt A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
sandwich; 11 strands in 2 sheets; greek-keySuperfamily b.26.1: SMAD/FHA domain [49879] (5 families) 
has a few short helices inserted in loops
Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
weak sequence similarity to SMAD domainProtein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101632] (3 PDB entries) 
Domain d1qwta_: 1qwt A: [96501]
complexed with po4
Details for d1qwta_
PDB Entry: 1qwt (more details), 2.1 Å
PDB Description: Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
PDB Compounds: (A:) Interferon regulatory factor 3SCOPe Domain Sequences for d1qwta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwta_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges
SCOPe Domain Coordinates for d1qwta_:
Click to download the PDB-style file with coordinates for d1qwta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qwta_:
- d1qwta_ first appeared in SCOP 1.67
- d1qwta_ appears in SCOPe 2.04
- d1qwta_ appears in SCOPe 2.06
- d1qwta_ appears in the current release, SCOPe 2.08
View in 3D
