Lineage for d1qwla_ (1qwl A:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742603Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 742604Superfamily e.5.1: Heme-dependent catalase-like [56634] (2 families) (S)
  5. 742605Family e.5.1.1: Heme-dependent catalases [56635] (2 proteins)
  6. 742606Protein Catalase I [56636] (8 species)
  7. 742642Species Helicobacter pylori [TaxId:210] [103392] (3 PDB entries)
  8. 742643Domain d1qwla_: 1qwl A: [96483]

Details for d1qwla_

PDB Entry: 1qwl (more details), 1.6 Å

PDB Description: Structure of Helicobacter pylori catalase
PDB Compounds: (A:) KatA Catalase

SCOP Domain Sequences for d1qwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]}
mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
kalekhqkmmk

SCOP Domain Coordinates for d1qwla_:

Click to download the PDB-style file with coordinates for d1qwla_.
(The format of our PDB-style files is described here.)

Timeline for d1qwla_: