Lineage for d1quea1 (1que A:1-141)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792139Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1792176Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 1792202Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (19 PDB entries)
  8. 1792207Domain d1quea1: 1que A:1-141 [25647]
    Other proteins in same PDB: d1quea2
    complexed with fad, so4

Details for d1quea1

PDB Entry: 1que (more details), 1.8 Å

PDB Description: x-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms
PDB Compounds: (A:) ferredoxin--nadp+ reductase

SCOPe Domain Sequences for d1quea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quea1 b.43.4.2 (A:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

SCOPe Domain Coordinates for d1quea1:

Click to download the PDB-style file with coordinates for d1quea1.
(The format of our PDB-style files is described here.)

Timeline for d1quea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1quea2