Lineage for d1quea1 (1que A:1-141)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) 
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
coupled with a NADP-binding domain of alpha/beta class
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) - Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (19 PDB entries)
Domain d1quea1: 1que A:1-141 [25647]
Other proteins in same PDB: d1quea2
complexed with fad, so4
Details for d1quea1
PDB Entry: 1que (more details), 1.8 Å
PDB Description: x-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms
PDB Compounds: (A:) ferredoxin--nadp+ reductaseSCOPe Domain Sequences for d1quea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1quea1 b.43.4.2 (A:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml
SCOPe Domain Coordinates for d1quea1:
Click to download the PDB-style file with coordinates for d1quea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1quea1:
- d1quea1 first appeared (with stable ids) in SCOP 1.55, called d1que_1
- d1quea1 appears in SCOPe 2.03
- d1quea1 appears in SCOPe 2.05
- d1quea1 appears in the current release, SCOPe 2.08
View in 3D
