Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein beta2-glycoprotein I [57543] (1 species) consists of five modules with the C-terminal module fold being altered |
Species Human (Homo sapiens) [TaxId:9606] [57544] (11 PDB entries) |
Domain d1quba4: 1qub A:184-243 [44866] complexed with nag |
PDB Entry: 1qub (more details), 2.7 Å
SCOPe Domain Sequences for d1quba4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} vkcpfpsrpdngfvnypakptlyykdkatfgchdgysldgpeeiectklgnwsampscka
Timeline for d1quba4:
View in 3D Domains from same chain: (mouse over for more information) d1quba1, d1quba2, d1quba3, d1quba5 |