Lineage for d1quba3 (1qub A:121-183)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034017Protein beta2-glycoprotein I [57543] (1 species)
    consists of five modules with the C-terminal module fold being altered
  7. 3034018Species Human (Homo sapiens) [TaxId:9606] [57544] (11 PDB entries)
  8. 3034028Domain d1quba3: 1qub A:121-183 [44865]
    complexed with nag

Details for d1quba3

PDB Entry: 1qub (more details), 2.7 Å

PDB Description: crystal structure of the glycosylated five-domain human beta2- glycoprotein i purified from blood plasma
PDB Compounds: (A:) PROTEIN (human beta2-Glycoprotein I)

SCOPe Domain Sequences for d1quba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}
iicpppsiptfatlrvykpsagnnslyrdtavfeclpqhamfgndtitctthgnwtklpe
cre

SCOPe Domain Coordinates for d1quba3:

Click to download the PDB-style file with coordinates for d1quba3.
(The format of our PDB-style files is described here.)

Timeline for d1quba3: