Lineage for d1quaa_ (1qua A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212308Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 1212313Protein Snake venom metalloprotease [55520] (7 species)
  7. 1212314Species Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId:36307] [55524] (1 PDB entry)
  8. 1212315Domain d1quaa_: 1qua A: [40330]
    complexed with zn

Details for d1quaa_

PDB Entry: 1qua (more details), 2.2 Å

PDB Description: crystal structure of acutolysin-c, a hemorrhagic toxin from the snake venom of agkistrodon acutus, at 2.2 a resolution
PDB Compounds: (A:) acutolysin-c

SCOPe Domain Sequences for d1quaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]}
papqtsielflivdhsmyakynsnsskitttlkarvnimnaiysslnlvitlsgiemwsa
adlitvqsssrntlklfaswretdllkrtsndnaqlltatnfngntvglaylktmcnsky
svgliqdhsaipllmavtmahelghnlgmnhdgagcscatcimapvlssgpaksfsdcsk
hdyqsfltihkpqclln

SCOPe Domain Coordinates for d1quaa_:

Click to download the PDB-style file with coordinates for d1quaa_.
(The format of our PDB-style files is described here.)

Timeline for d1quaa_: