Lineage for d1qtwa_ (1qtw A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101025Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2101026Family c.1.15.1: Endonuclease IV [51659] (2 proteins)
  6. 2101027Protein Endonuclease IV [51660] (2 species)
    DNA repair enzyme
  7. 2101030Species Escherichia coli [TaxId:562] [51661] (5 PDB entries)
  8. 2101031Domain d1qtwa_: 1qtw A: [29392]
    complexed with zn

Details for d1qtwa_

PDB Entry: 1qtw (more details), 1.02 Å

PDB Description: high-resolution crystal structure of the escherichia coli dna repair enzyme endonuclease iv
PDB Compounds: (A:) endonuclease IV

SCOPe Domain Sequences for d1qtwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]}
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqtekava

SCOPe Domain Coordinates for d1qtwa_:

Click to download the PDB-style file with coordinates for d1qtwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qtwa_: