Lineage for d1qtqa2 (1qtq A:8-338)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
contains a conserved all-alpha subdomain at the C-terminal extension
Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (2 species) Species Escherichia coli [TaxId:562] [52381] (17 PDB entries) 
Domain d1qtqa2: 1qtq A:8-338 [31579]
Other proteins in same PDB: d1qtqa1
protein/RNA complex; complexed with qsi, so4
Details for d1qtqa2
PDB Entry: 1qtq (more details), 2.25 Å
PDB Description: glutaminyl-trna synthetase complexed with trna and an amino acid analog
PDB Compounds: (A:) protein (glutaminyl-tRNA synthetase)SCOPe Domain Sequences for d1qtqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtqa2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen
SCOPe Domain Coordinates for d1qtqa2:
Click to download the PDB-style file with coordinates for d1qtqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qtqa2:
- d1qtqa2 first appeared (with stable ids) in SCOP 1.55
- d1qtqa2 appears in SCOPe 2.05
- d1qtqa2 appears in SCOPe 2.07
- d1qtqa2 appears in the current release, SCOPe 2.08
View in 3D
