Lineage for d1qs0b1 (1qs0 B:2-205)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) 
there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
parent family to TK and PFOR
heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
automatically mapped to Pfam PF02779
Protein 2-oxoisovalerate dehydrogenase (E1B), Pyr module [88744] (1 species)
chain A is alpha-subunit and chain B is beta-subunitSpecies Pseudomonas putida [TaxId:303] [88745] (1 PDB entry) 
Domain d1qs0b1: 1qs0 B:2-205 [31830]
Other proteins in same PDB: d1qs0a_, d1qs0b2
complexed with coi, mg, tdp
Details for d1qs0b1
PDB Entry: 1qs0 (more details), 2.4 Å
PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta-subunitSCOPe Domain Sequences for d1qs0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]}
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdg
SCOPe Domain Coordinates for d1qs0b1:
Click to download the PDB-style file with coordinates for d1qs0b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qs0b1:
View in 3D
