Lineage for d1qs0a_ (1qs0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361943Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1361944Protein 2-oxoisovalerate dehydrogenase (E1B), PP module [88769] (1 species)
    chain A is alpha-subunit and chain B is beta-subunit
  7. 1361945Species Pseudomonas putida [TaxId:303] [88770] (1 PDB entry)
  8. 1361946Domain d1qs0a_: 1qs0 A: [31829]
    Other proteins in same PDB: d1qs0b1, d1qs0b2
    complexed with coi, mg, tdp

Details for d1qs0a_

PDB Entry: 1qs0 (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
PDB Compounds: (A:) 2-oxoisovalerate dehydrogenase alpha-subunit

SCOPe Domain Sequences for d1qs0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]}
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel

SCOPe Domain Coordinates for d1qs0a_:

Click to download the PDB-style file with coordinates for d1qs0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qs0a_: