Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein 2-oxoisovalerate dehydrogenase (E1B), PP module [88769] (1 species) chain A is alpha-subunit and chain B is beta-subunit |
Species Pseudomonas putida [TaxId:303] [88770] (1 PDB entry) |
Domain d1qs0a_: 1qs0 A: [31829] Other proteins in same PDB: d1qs0b1, d1qs0b2 complexed with coi, mg, tdp |
PDB Entry: 1qs0 (more details), 2.4 Å
SCOPe Domain Sequences for d1qs0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
Timeline for d1qs0a_: