Lineage for d1qrva_ (1qrv A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.21: HMG-box [47094] (1 superfamily)
3 helices; irregular arraySuperfamily a.21.1: HMG-box [47095] (2 families) 
Family a.21.1.1: HMG-box [47096] (10 proteins) 
Protein HMG-D [47100] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries) 
Domain d1qrva_: 1qrv A: [16425]
protein/DNA complex; complexed with na
Details for d1qrva_
PDB Entry: 1qrv (more details), 2.2 Å
PDB Description: crystal structure of the complex of hmg-d and dna
PDB Compounds: (A:) high mobility group protein dSCOPe Domain Sequences for d1qrva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrva_ a.21.1.1 (A:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang
SCOPe Domain Coordinates for d1qrva_:
Click to download the PDB-style file with coordinates for d1qrva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qrva_:
- d1qrva_ first appeared (with stable ids) in SCOP 1.55
- d1qrva_ appears in SCOPe 2.07
View in 3D
