SCOPe 2.08: Domain d1qrne1: 1qrn E:3-118

Lineage for d1qrne1 (1qrn E:3-118)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
Domain d1qrne1: 1qrn E:3-118 [20647]
Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb2, d1qrnb3, d1qrnd2, d1qrne2

Details for d1qrne1

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

PDB Compounds: (E:) T-cell receptor, beta chain

SCOPe Domain Sequences for d1qrne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrne1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOPe Domain Coordinates for d1qrne1:

Click to download the PDB-style file with coordinates for d1qrne1.
(The format of our PDB-style files is described here.)

Timeline for d1qrne1: