Lineage for d1qrnd2 (1qrn D:118-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361045Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2361071Domain d1qrnd2: 1qrn D:118-206 [21558]
    Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb2, d1qrnb3, d1qrnd1, d1qrne1

Details for d1qrnd2

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a
PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d1qrnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrnd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdkdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d1qrnd2:

Click to download the PDB-style file with coordinates for d1qrnd2.
(The format of our PDB-style files is described here.)

Timeline for d1qrnd2: