Lineage for d1qr0a1 (1qr0 A:1-101)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
beta-alpha(3)-beta(2) motifSuperfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) 
possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (2 proteins)
monomeric; tandem duplication of beta-alpha(3)-beta(2) motifProtein 4'-Phosphopantetheinyl transferase SFP [63407] (1 species) Species Bacillus subtilis [TaxId:1423] [56217] (1 PDB entry) 
Domain d1qr0a1: 1qr0 A:1-101 [59038]
complexed with coa, mg
Details for d1qr0a1
PDB Entry: 1qr0 (more details), 1.9 Å
PDB Description: crystal structure of the 4'-phosphopantetheinyl transferase sfp- coenzyme a complex
PDB Compounds: (A:) 4'-phosphopantetheinyl transferase sfpSCOPe Domain Sequences for d1qr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qr0a1 d.150.1.1 (A:1-101) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]}
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds
SCOPe Domain Coordinates for d1qr0a1:
Click to download the PDB-style file with coordinates for d1qr0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qr0a1:
- d1qr0a1 first appeared in SCOP 1.57
- d1qr0a1 appears in SCOPe 2.04
- d1qr0a1 appears in SCOPe 2.06
- d1qr0a1 appears in the current release, SCOPe 2.08
View in 3D
