Lineage for d1qqva_ (1qqv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262136Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 1262137Superfamily a.14.1: VHP, Villin headpiece domain [47050] (1 family) (S)
  5. 1262138Family a.14.1.1: VHP, Villin headpiece domain [47051] (4 proteins)
  6. 1262148Protein Villin [47052] (2 species)
  7. 1262149Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 1262165Domain d1qqva_: 1qqv A: [16379]

Details for d1qqva_

PDB Entry: 1qqv (more details)

PDB Description: solution structure of the headpiece domain of chicken villin
PDB Compounds: (A:) villin headpiece domain

SCOPe Domain Sequences for d1qqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqva_ a.14.1.1 (A:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
kkekglf

SCOPe Domain Coordinates for d1qqva_:

Click to download the PDB-style file with coordinates for d1qqva_.
(The format of our PDB-style files is described here.)

Timeline for d1qqva_: