Lineage for d1qqca1 (1qqc A:1-347)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (14 families) 
consists of one domain of this fold
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
contains Pfam PF00929
Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
elaborated with additional structures and the N-terminal subdomain
Species Archaeon Desulfurococcus tok [TaxId:108142] [53130] (2 PDB entries)
additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold
Domain d1qqca1: 1qqc A:1-347 [33724]
Other proteins in same PDB: d1qqca2
complexed with mg, so4
Details for d1qqca1
PDB Entry: 1qqc (more details), 2.6 Å
PDB Description: crystal structure of an archaebacterial dna polymerase d.tok
PDB Compounds: (A:) DNA polymerase IISCOP Domain Sequences for d1qqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqca1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Desulfurococcus tok [TaxId: 108142]}
mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
lidrglipmegdeelrmlafdietlyhegeefgegpilmisyadeegarvitwknidlpy
vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpkekvyaeeiarawe
sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrs
SCOP Domain Coordinates for d1qqca1:
Click to download the PDB-style file with coordinates for d1qqca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqca1:
- d1qqca1 first appeared (with stable ids) in SCOP 1.55
- d1qqca1 appears in SCOP 1.73
- d1qqca1 appears in SCOPe 2.01
- d1qqca1 appears in the current release, SCOPe 2.08
View in 3D
