Lineage for d1qpwb_ (1qpw B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1977443Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1978096Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries)
  8. 1978097Domain d1qpwb_: 1qpw B: [15569]
    Other proteins in same PDB: d1qpwa_, d1qpwc_
    complexed with hem, oxy

Details for d1qpwb_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution
PDB Compounds: (B:) poricine hemoglobin (beta subunit)

SCOPe Domain Sequences for d1qpwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

SCOPe Domain Coordinates for d1qpwb_:

Click to download the PDB-style file with coordinates for d1qpwb_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwb_: