Lineage for d1qpia2 (1qpi A:68-206)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) Species Escherichia coli [TaxId:562] [48501] (37 PDB entries) 
Domain d1qpia2: 1qpi A:68-206 [19249]
Other proteins in same PDB: d1qpia1
protein/DNA complex; complexed with imd
Details for d1qpia2
PDB Entry: 1qpi (more details), 2.5 Å
PDB Description: crystal structure of tetracycline repressor/operator complex
PDB Compounds: (A:) protein (tetracycline repressor)SCOPe Domain Sequences for d1qpia2:
Sequence, based on SEQRES records: (download)
>d1qpia2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallq
Sequence, based on observed residues (ATOM records): (download)
>d1qpia2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalenlppllrealqimdsddgeqaflhgleslir
gfevqltallq
SCOPe Domain Coordinates for d1qpia2:
Click to download the PDB-style file with coordinates for d1qpia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qpia2:
- d1qpia2 first appeared (with stable ids) in SCOP 1.55
- d1qpia2 appears in SCOPe 2.07
View in 3D
