Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
Species Escherichia coli [TaxId:562] [46766] (36 PDB entries) |
Domain d1qpia1: 1qpi A:4-67 [16072] Other proteins in same PDB: d1qpia2 protein/DNA complex; complexed with imd |
PDB Entry: 1qpi (more details), 2.5 Å
SCOPe Domain Sequences for d1qpia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpia1 a.4.1.9 (A:4-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh hdys
Timeline for d1qpia1: