Lineage for d1qp2a_ (1qp2 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393377Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2393378Protein Photosystem I accessory protein E (PsaE) [50095] (5 species)
  7. 2393379Species Nostoc sp., strain pcc8009 [TaxId:1180] [50097] (2 PDB entries)
  8. 2393380Domain d1qp2a_: 1qp2 A: [24596]

Details for d1qp2a_

PDB Entry: 1qp2 (more details)

PDB Description: solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
PDB Compounds: (A:) protein (psae protein)

SCOPe Domain Sequences for d1qp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp2a_ b.34.4.2 (A:) Photosystem I accessory protein E (PsaE) {Nostoc sp., strain pcc8009 [TaxId: 1180]}
mvqrgskvrilrpesywfqdvgtvasvdqsgikypvivrfekvnysgintnnfaedelve
veapkakpkk

SCOPe Domain Coordinates for d1qp2a_:

Click to download the PDB-style file with coordinates for d1qp2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qp2a_: