Lineage for d1qoub_ (1qou B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.17: PEBP-like [49776] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like foldsSuperfamily b.17.1: PEBP-like [49777] (3 families) 
Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) 
Protein Centroradialis protein Cen [49782] (1 species) Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [49783] (1 PDB entry) 
Domain d1qoub_: 1qou B: [23708]
Details for d1qoub_
PDB Entry: 1qou (more details), 1.9 Å
PDB Description: cen (centroradialis) protein from antirrhinum
PDB Compounds: (B:) cenSCOPe Domain Sequences for d1qoub_:
Sequence, based on SEQRES records: (download)
>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
vssdplvigrvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprvevhgg
dmrsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihr
fvfllfkqkkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqre
Sequence, based on observed residues (ATOM records): (download)
>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
vssdplvigrvigdvvdhftstvkmsviynssikhvynghelfpsavtstprvevhggdm
rsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfv
fllfkqkkrvvcrdgfntrkftqenelglpvaavffncqre
SCOPe Domain Coordinates for d1qoub_:
Click to download the PDB-style file with coordinates for d1qoub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qoub_:
- d1qoub_ first appeared (with stable ids) in SCOP 1.55
- d1qoub_ appears in SCOPe 2.07
View in 3D
