Lineage for d1qoka2 (1qok A:162-267)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
Domain d1qoka2: 1qok A:162-267 [20493]
Other proteins in same PDB: d1qoka1
part of anti-carcinoembryonic scFv MFE-23
Details for d1qoka2
PDB Entry: 1qok (more details), 2.4 Å
PDB Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
PDB Compounds: (A:) mfe-23 recombinant antibody fragmentSCOPe Domain Sequences for d1qoka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoka2 b.1.1.1 (A:162-267) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
envltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklelk
SCOPe Domain Coordinates for d1qoka2:
Click to download the PDB-style file with coordinates for d1qoka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qoka2:
- d1qoka2 first appeared (with stable ids) in SCOP 1.55
- d1qoka2 appears in SCOPe 2.04
- d1qoka2 appears in SCOPe 2.06
- d1qoka2 appears in the current release, SCOPe 2.08
View in 3D
