Lineage for d1qoka1 (1qok A:27-147)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries)
SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
Domain d1qoka1: 1qok A:27-147 [20492]
Other proteins in same PDB: d1qoka2
part of anti-carcinoembryonic scFv MFE-23
Details for d1qoka1
PDB Entry: 1qok (more details), 2.4 Å
PDB Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
PDB Compounds: (A:) mfe-23 recombinant antibody fragmentSCOPe Domain Sequences for d1qoka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoka1 b.1.1.1 (A:27-147) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qvklqqsgaelvrsgtsvklsctasgfnikdsymhwlrqgpeqglewigwidpengdtey
apkfqgkatfttdtssntaylqlssltsedtavyycnegtptgpyyfdywgqgttvtvss
g
SCOPe Domain Coordinates for d1qoka1:
Click to download the PDB-style file with coordinates for d1qoka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qoka1:
- d1qoka1 first appeared (with stable ids) in SCOP 1.55
- d1qoka1 appears in SCOPe 2.07
View in 3D
