Lineage for d1qo3a2 (1qo3 A:2-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545128Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2545151Domain d1qo3a2: 1qo3 A:2-181 [38310]
    Other proteins in same PDB: d1qo3a1, d1qo3b2, d1qo3b3, d1qo3c_, d1qo3d_
    complexed with edo

Details for d1qo3a2

PDB Entry: 1qo3 (more details), 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd
PDB Compounds: (A:) MHC class I h-2dd heavy chain

SCOPe Domain Sequences for d1qo3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo3a2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

SCOPe Domain Coordinates for d1qo3a2:

Click to download the PDB-style file with coordinates for d1qo3a2.
(The format of our PDB-style files is described here.)

Timeline for d1qo3a2:

2545151
d1qo3a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qo3a1