Lineage for d1qo3a1 (1qo3 A:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358446Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2358559Domain d1qo3a1: 1qo3 A:182-275 [20841]
    Other proteins in same PDB: d1qo3a2, d1qo3b2, d1qo3b3, d1qo3c_, d1qo3d_
    complexed with edo

Details for d1qo3a1

PDB Entry: 1qo3 (more details), 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd
PDB Compounds: (A:) MHC class I h-2dd heavy chain

SCOPe Domain Sequences for d1qo3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo3a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf
qkwasvvvplgkeqkytchveheglpepltlrwg

SCOPe Domain Coordinates for d1qo3a1:

Click to download the PDB-style file with coordinates for d1qo3a1.
(The format of our PDB-style files is described here.)

Timeline for d1qo3a1:

2358559
d1qo3a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qo3a2