![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
![]() | Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) |
![]() | Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
![]() | Species Synechococcus elongatus [TaxId:32046] [52429] (7 PDB entries) Uniprot P05327 1-474 cofactor is HDF |
![]() | Domain d1qnfa2: 1qnf A:1-204 [31632] Other proteins in same PDB: d1qnfa1 complexed with fad, hdf |
PDB Entry: 1qnf (more details), 1.8 Å
SCOPe Domain Sequences for d1qnfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnfa2 c.28.1.1 (A:1-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt aiaplllselptlkqlgfdwdggf
Timeline for d1qnfa2: