Lineage for d1qlwb_ (1qlw B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.15: A novel bacterial esterase [53552] (2 proteins) Protein A novel bacterial esterase [53553] (1 species) Species Alcaligenes sp. [TaxId:512] [53554] (1 PDB entry) 
Domain d1qlwb_: 1qlw B: [34723]
complexed with so4
Details for d1qlwb_
PDB Entry: 1qlw (more details), 1.09 Å
PDB Description: the atomic resolution structure of a novel bacterial esterase
PDB Compounds: (B:) esteraseSCOPe Domain Sequences for d1qlwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlwb_ c.69.1.15 (B:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}
vpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakryp
itlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgk
apasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpn
ptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkplt
sipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdr
nnlqvadlildwigrnt
SCOPe Domain Coordinates for d1qlwb_:
Click to download the PDB-style file with coordinates for d1qlwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlwb_:
- d1qlwb_ first appeared (with stable ids) in SCOP 1.55
- d1qlwb_ appears in SCOPe 2.05
- d1qlwb_ appears in SCOPe 2.07
- d1qlwb_ appears in the current release, SCOPe 2.08
View in 3D
