| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein Fumarate reductase [46550] (3 species) |
| Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries) |
| Domain d1qlbb1: 1qlb B:107-239 [15681] Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe2, d1qlbf_ complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4 |
PDB Entry: 1qlb (more details), 2.33 Å
SCOPe Domain Sequences for d1qlbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlbb1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn
Timeline for d1qlbb1: