Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries) |
Domain d1ql6a_: 1ql6 A: [41636] complexed with atp, mn, so4; mutant |
PDB Entry: 1ql6 (more details), 2.4 Å
SCOPe Domain Sequences for d1ql6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ql6a_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} sthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreat lkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkim rallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrsvcgtpsyl apeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgs pewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyv
Timeline for d1ql6a_: