Lineage for d1qhka_ (1qhk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573862Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2573863Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2573913Family d.100.1.2: N-terminal domain of RNase HI [55662] (1 protein)
    automatically mapped to Pfam PF01693
  6. 2573914Protein N-terminal domain of RNase HI [55663] (1 species)
  7. 2573915Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55664] (1 PDB entry)
  8. 2573916Domain d1qhka_: 1qhk A: [40694]

Details for d1qhka_

PDB Entry: 1qhk (more details)

PDB Description: n-terminal domain of saccharomyces cerevisiae rnase hi reveals a fold with a resemblance to the n-terminal domain of ribosomal protein l9
PDB Compounds: (A:) protein (ribonuclease hi)

SCOPe Domain Sequences for d1qhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhka_ d.100.1.2 (A:) N-terminal domain of RNase HI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gnfyavrkgretgiyntwnecknqvdgyggaiykkfnsyeqaksflg

SCOPe Domain Coordinates for d1qhka_:

Click to download the PDB-style file with coordinates for d1qhka_.
(The format of our PDB-style files is described here.)

Timeline for d1qhka_: