Lineage for d1qgoa_ (1qgo A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008155Family c.92.1.2: Cobalt chelatase CbiK [53804] (2 proteins)
  6. 1008156Protein Cobalt chelatase CbiK [53805] (1 species)
  7. 1008157Species Salmonella typhimurium [TaxId:90371] [53806] (1 PDB entry)
  8. 1008158Domain d1qgoa_: 1qgo A: [35596]
    CASP3
    complexed with so4

Details for d1qgoa_

PDB Entry: 1qgo (more details), 2.4 Å

PDB Description: anaerobic cobalt chelatase in cobalamin biosynthesis from salmonella typhimurium
PDB Compounds: (A:) anaerobic cobalamin biosynthetic cobalt chelatase

SCOPe Domain Sequences for d1qgoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgoa_ c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 90371]}
kkallvvsfgtsyhdtceknivacerdlaascpdrdlfraftsgmiirklrqrdgididt
plqalqklaaqgyqdvaiqslhiingdeyekivrevqllrplftrltlgvpllsshndyv
qlmqalrqqmpslrqtekvvfmghgashhafaayacldhmmtaqrfparvgavesypevd
ilidslrdegvtgvhlmplmlvagdhaindmasddgdswkmrfnaagipatpwlsglgen
pairamfvahlhqalnm

SCOPe Domain Coordinates for d1qgoa_:

Click to download the PDB-style file with coordinates for d1qgoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgoa_: