![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.2: Cobalt chelatase CbiK [53804] (2 proteins) |
![]() | Protein Cobalt chelatase CbiK [53805] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [53806] (1 PDB entry) |
![]() | Domain d1qgoa_: 1qgo A: [35596] CASP3 complexed with so4 |
PDB Entry: 1qgo (more details), 2.4 Å
SCOPe Domain Sequences for d1qgoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgoa_ c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 90371]} kkallvvsfgtsyhdtceknivacerdlaascpdrdlfraftsgmiirklrqrdgididt plqalqklaaqgyqdvaiqslhiingdeyekivrevqllrplftrltlgvpllsshndyv qlmqalrqqmpslrqtekvvfmghgashhafaayacldhmmtaqrfparvgavesypevd ilidslrdegvtgvhlmplmlvagdhaindmasddgdswkmrfnaagipatpwlsglgen pairamfvahlhqalnm
Timeline for d1qgoa_: