Lineage for d1qg4b_ (1qg4 B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (80 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Ran [52609] (2 species) 
Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
Uniprot P62825
Domain d1qg4b_: 1qg4 B: [32036]
complexed with gdp, mg; mutant
Details for d1qg4b_
PDB Entry: 1qg4 (more details), 2.5 Å
PDB Description: canine gdp-ran f72y mutant
PDB Compounds: (B:) protein (ran)SCOPe Domain Sequences for d1qg4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qg4b_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikf
nvwdtagqekygglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
lappevvmdpalaaqyehdlevaqttalpdedddl
SCOPe Domain Coordinates for d1qg4b_:
Click to download the PDB-style file with coordinates for d1qg4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qg4b_:
View in 3D
