Lineage for d1qg4b_ (1qg4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867618Protein Ran [52609] (2 species)
  7. 2867619Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
    Uniprot P62825
  8. 2867629Domain d1qg4b_: 1qg4 B: [32036]
    complexed with gdp, mg; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1qg4b_

PDB Entry: 1qg4 (more details), 2.5 Å

PDB Description: canine gdp-ran f72y mutant
PDB Compounds: (B:) protein (ran)

SCOPe Domain Sequences for d1qg4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg4b_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikf
nvwdtagqekygglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
lappevvmdpalaaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d1qg4b_:

Click to download the PDB-style file with coordinates for d1qg4b_.
(The format of our PDB-style files is described here.)

Timeline for d1qg4b_: