Lineage for d1qcrf_ (1qcr F:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255648Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2255649Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 2255650Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 2255651Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 2255662Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
    Uniprot P00129
  8. 2255679Domain d1qcrf_: 1qcr F: [43676]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
    complexed with hem

Details for d1qcrf_

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
PDB Compounds: (F:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1qcrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
assrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikrald
lsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1qcrf_:

Click to download the PDB-style file with coordinates for d1qcrf_.
(The format of our PDB-style files is described here.)

Timeline for d1qcrf_: