![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.19: Z-DNA binding domain [46853] (4 proteins) Pfam PF02295 |
![]() | Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46855] (5 PDB entries) |
![]() | Domain d1qbjc_: 1qbj C: [16157] protein/DNA complex |
PDB Entry: 1qbj (more details), 2.1 Å
SCOP Domain Sequences for d1qbjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbjc_ a.4.5.19 (C:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} siyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpp lwkiav
Timeline for d1qbjc_: