Lineage for d1qbha_ (1qbh A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264524Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2264525Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2264526Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2264527Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 2264528Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)
  8. 2264541Domain d1qbha_: 1qbh A: [45374]
    complexed with zn

Details for d1qbha_

PDB Entry: 1qbh (more details)

PDB Description: solution structure of a baculoviral inhibitor of apoptosis (iap) repeat
PDB Compounds: (A:) inhibitor of apoptosis protein (2mihb/c-iap-1)

SCOPe Domain Sequences for d1qbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbha_ g.52.1.1 (A:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
gshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgryphlleqllsts

SCOPe Domain Coordinates for d1qbha_:

Click to download the PDB-style file with coordinates for d1qbha_.
(The format of our PDB-style files is described here.)

Timeline for d1qbha_: