![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein 2MIHB/C-IAP-1 [57926] (1 species) baculoviral inhibitor of apoptosis |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries) |
![]() | Domain d1qbha_: 1qbh A: [45374] complexed with zn |
PDB Entry: 1qbh (more details)
SCOPe Domain Sequences for d1qbha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbha_ g.52.1.1 (A:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} gshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp wvehakwfprceflirmkgqefvdeiqgryphlleqllsts
Timeline for d1qbha_: