Lineage for d1qada_ (1qad A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1919025Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 1919026Species Cow (Bos taurus) [TaxId:9913] [55570] (7 PDB entries)
  8. 1919027Domain d1qada_: 1qad A: [40498]
    C-terminal SH2 domain

Details for d1qada_

PDB Entry: 1qad (more details), 1.8 Å

PDB Description: Crystal Structure of the C-Terminal SH2 Domain of the P85 alpha Regulatory Subunit of Phosphoinositide 3-Kinase: An SH2 domain mimicking its own substrate
PDB Compounds: (A:) pi3-kinase p85 alpha subunit

SCOPe Domain Sequences for d1qada_:

Sequence, based on SEQRES records: (download)

>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya

Sequence, based on observed residues (ATOM records): (download)

>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresgcyacsvvvdgevkhcvinkta
tgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya

SCOPe Domain Coordinates for d1qada_:

Click to download the PDB-style file with coordinates for d1qada_.
(The format of our PDB-style files is described here.)

Timeline for d1qada_: