Lineage for d1q8oa_ (1q8o A:)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Legume lectin [49904] (23 species) 
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries) 
Domain d1q8oa_: 1q8o A: [96219]
Details for d1q8oa_
PDB Entry: 1q8o (more details), 2.2 Å
PDB Description: pterocartpus angolensis lectin pal in complex with the dimmanoside man(alpha1-2)man
PDB Compounds: (A:) lectinSCOP Domain Sequences for d1q8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8oa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a
SCOP Domain Coordinates for d1q8oa_:
Click to download the PDB-style file with coordinates for d1q8oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q8oa_:
- d1q8oa_ first appeared in SCOP 1.67
- d1q8oa_ appears in SCOP 1.71
- d1q8oa_ appears in SCOP 1.75
- d1q8oa_ appears in the current release, SCOPe 2.08
View in 3D
