Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) |
Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins) Pfam PF01981; UPF0099 |
Protein Bit1 (Cgi-147) [102464] (1 species) Peptidyl-tRNA hydrolase; involved in apoptosis |
Species Human (Homo sapiens) [TaxId:9606] [102465] (1 PDB entry) |
Domain d1q7sa_: 1q7s A: [96055] |
PDB Entry: 1q7s (more details), 2 Å
SCOPe Domain Sequences for d1q7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q7sa_ c.131.1.1 (A:) Bit1 (Cgi-147) {Human (Homo sapiens) [TaxId: 9606]} geykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapd eetliallahakmlgltvsliqdagrtqiapgsqtvlgigpgpadlidkvtghlkly
Timeline for d1q7sa_: