Lineage for d1q7sa_ (1q7s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923056Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 2923057Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 2923058Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
    Pfam PF01981; UPF0099
  6. 2923059Protein Bit1 (Cgi-147) [102464] (1 species)
    Peptidyl-tRNA hydrolase; involved in apoptosis
  7. 2923060Species Human (Homo sapiens) [TaxId:9606] [102465] (1 PDB entry)
  8. 2923061Domain d1q7sa_: 1q7s A: [96055]

Details for d1q7sa_

PDB Entry: 1q7s (more details), 2 Å

PDB Description: Crystal structure of bit1
PDB Compounds: (A:) bit1

SCOPe Domain Sequences for d1q7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7sa_ c.131.1.1 (A:) Bit1 (Cgi-147) {Human (Homo sapiens) [TaxId: 9606]}
geykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapd
eetliallahakmlgltvsliqdagrtqiapgsqtvlgigpgpadlidkvtghlkly

SCOPe Domain Coordinates for d1q7sa_:

Click to download the PDB-style file with coordinates for d1q7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1q7sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q7sb_