Lineage for d1q7ra_ (1q7r A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358418Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1358535Protein Hypothetical protein YaaE [102250] (4 species)
    glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis
  7. 1358536Species Bacillus stearothermophilus [TaxId:1422] [102252] (1 PDB entry)
  8. 1358537Domain d1q7ra_: 1q7r A: [96054]
    structural genomics
    complexed with cl, edo, so4

Details for d1q7ra_

PDB Entry: 1q7r (more details), 1.9 Å

PDB Description: X-ray crystallographic analysis of a predicted amidotransferase from B. stearothermophilus at 1.9 A resolution
PDB Compounds: (A:) predicted amidotransferase

SCOPe Domain Sequences for d1q7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]}
lyfqsnmkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrl
idryglmeplkqfaaagkpmfgtcaglillakrivgydephlglmditvernsfgrqres
feaelsikgvgdgfvgvfiraphiveagdgvdvlatyndrivaarqgqflgcsfhpeltd
dhrlmqyflnmvkeakmasslk

SCOPe Domain Coordinates for d1q7ra_:

Click to download the PDB-style file with coordinates for d1q7ra_.
(The format of our PDB-style files is described here.)

Timeline for d1q7ra_: