Lineage for d1q7ca_ (1q7c A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1346893Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 1346894Species Escherichia coli [TaxId:562] [51790] (3 PDB entries)
  8. 1346899Domain d1q7ca_: 1q7c A: [96030]
    complexed with nap; mutant

Details for d1q7ca_

PDB Entry: 1q7c (more details), 2.5 Å

PDB Description: the structure of betaketoacyl-[acp] reductase y151f mutant in complex with nadph fragment
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d1q7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7ca_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}
nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
mrammkkrhgriitigsvvgtmgnggqanfaaakagligfskslarevasrgitvnvvap
gfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm
ymv

SCOPe Domain Coordinates for d1q7ca_:

Click to download the PDB-style file with coordinates for d1q7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1q7ca_: