Lineage for d1q6za3 (1q6z A:342-524)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864860Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2864903Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 2864904Species Pseudomonas putida [TaxId:303] [88757] (7 PDB entries)
    Uniprot P20906
  8. 2864905Domain d1q6za3: 1q6z A:342-524 [111657]
    Other proteins in same PDB: d1q6za1, d1q6za2
    complexed with ca, mg, tzd; mutant

Details for d1q6za3

PDB Entry: 1q6z (more details), 1 Å

PDB Description: high resolution structure of e28a mutant benzoylformate decarboxylase from pseudomonas putida complexed with thiamin thiazolone diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1q6za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stv

SCOPe Domain Coordinates for d1q6za3:

Click to download the PDB-style file with coordinates for d1q6za3.
(The format of our PDB-style files is described here.)

Timeline for d1q6za3: