Lineage for d1q6xa2 (1q6x A:402-617)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851362Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1851363Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1851456Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 1851496Protein Choline O-acetyltransferase [110591] (2 species)
  7. 1851506Species Norway rat (Rattus norvegicus) [TaxId:10116] [110592] (2 PDB entries)
    Uniprot P32738
  8. 1851510Domain d1q6xa2: 1q6x A:402-617 [104542]
    complexed with na

Details for d1q6xa2

PDB Entry: 1q6x (more details), 2.5 Å

PDB Description: Crystal structure of rat choline acetyltransferase
PDB Compounds: (A:) choline O-acetyltransferase

SCOPe Domain Sequences for d1q6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6xa2 c.43.1.3 (A:402-617) Choline O-acetyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfivykfdnygktfikkqkyspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdn
irsatpealafvqamtdhkaampaseklqllqtamqaqteytvmaitgmaidnhllalre
lardlckeppemfmdetylmsnrfvlstsqvpttmemfccygpvvpngygacynpqpeai
tfcissfhscketssvefaeavgaslvdmrdlcssr

SCOPe Domain Coordinates for d1q6xa2:

Click to download the PDB-style file with coordinates for d1q6xa2.
(The format of our PDB-style files is described here.)

Timeline for d1q6xa2:

1851510
d1q6xa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1q6xa1