Lineage for d1q6xa1 (1q6x A:18-401)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the restSuperfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) 
Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domainsProtein Choline O-acetyltransferase [110591] (2 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [110592] (2 PDB entries)
Uniprot P32738
Domain d1q6xa1: 1q6x A:18-401 [104541]
complexed with na
Details for d1q6xa1
PDB Entry: 1q6x (more details), 2.5 Å
PDB Description: Crystal structure of rat choline acetyltransferase
PDB Compounds: (A:) choline O-acetyltransferaseSCOPe Domain Sequences for d1q6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6xa1 c.43.1.3 (A:18-401) Choline O-acetyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
weeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqeklle
rqektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsy
ktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehvi
vaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakar
tvllkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydks
lqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrw
kcspetqghlassaeklqrivknl
SCOPe Domain Coordinates for d1q6xa1:
Click to download the PDB-style file with coordinates for d1q6xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q6xa1:
- d1q6xa1 first appeared in SCOP 1.69
- d1q6xa1 appears in SCOPe 2.04
- d1q6xa1 appears in SCOPe 2.06
- d1q6xa1 appears in the current release, SCOPe 2.08
View in 3D
