Lineage for d1q6ha_ (1q6h A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) 
Protein Peptidyl-prolyl cis-trans isomerase FkpA [102866] (1 species)
similar to MIP; contains all-alpha dimerisation subdomain in the N-terminal extensionSpecies Escherichia coli [TaxId:562] [102867] (3 PDB entries) 
Domain d1q6ha_: 1q6h A: [95975]
has additional subdomain(s) that are not in the common domain
Details for d1q6ha_
PDB Entry: 1q6h (more details), 1.97 Å
PDB Description: Crystal structure of a truncated form of FkpA from Escherichia coli
PDB Compounds: (A:) FKBP-type peptidyl-prolyl cis-trans isomerase fkpASCOPe Domain Sequences for d1q6ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]}
afknddqksayalgaslgrymenslkeqeklgikldkdqliagvqdafadksklsdqeie
qtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktsstglvyqvveagkge
apkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteglknikkggkiklvi
ppelaygkagvpgippnstlvfdvelldvk
SCOPe Domain Coordinates for d1q6ha_:
Click to download the PDB-style file with coordinates for d1q6ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q6ha_:
- d1q6ha_ first appeared in SCOP 1.67
- d1q6ha_ appears in SCOPe 2.07
View in 3D
