Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins) automatically mapped to Pfam PF08753 |
Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
Species Escherichia coli [TaxId:562] [103001] (8 PDB entries) |
Domain d1q5ya_: 1q5y A: [95950] nickel-bound; C-terminal domain only complexed with edo, ni |
PDB Entry: 1q5y (more details), 1.4 Å
SCOPe Domain Sequences for d1q5ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5ya_ d.58.18.4 (A:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq hfaddviaqrgvrhghlqclpked
Timeline for d1q5ya_: