Lineage for d1q5va2 (1q5v A:49-132)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. Domain d1q5va2: 1q5v A:49-132 [95938]
    Other proteins in same PDB: d1q5va1, d1q5vb1, d1q5vc1, d1q5vd1
    apo form

Details for d1q5va2

PDB Entry: 1q5v (more details), 2.3 Å

PDB Description: Apo-NikR
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d1q5va2:

Sequence, based on SEQRES records: (download)

>d1q5va2 d.58.18.4 (A:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpke

Sequence, based on observed residues (ATOM records): (download)

>d1q5va2 d.58.18.4 (A:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhg
hlqclpke

SCOPe Domain Coordinates for d1q5va2 are not available.

Timeline for d1q5va2:

Domains from same chain:
(mouse over for more information)
d1q5va1
Domains from other chains:
(mouse over for more information)
d1q5vb1, d1q5vb2, d1q5vc1, d1q5vc2, d1q5vd1, d1q5vd2