Lineage for d1q4mb_ (1q4m B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345656Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2345657Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2345817Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2345847Protein Seed maturation protein-related At3g16990 [101461] (1 species)
  7. 2345848Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
    structural genomics
  8. 2345850Domain d1q4mb_: 1q4m B: [302911]
    automated match to d2f2gb_
    complexed with so4

Details for d1q4mb_

PDB Entry: 1q4m (more details), 2.08 Å

PDB Description: Gene Product of At3g16990 from Arabidopsis Thaliana
PDB Compounds: (B:) seed maturation protein -related

SCOPe Domain Sequences for d1q4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4mb_ a.132.1.3 (B:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvli
rackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlm
ssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvkni
aerclenasgevlgeaedvlvrvlelevafwemsrg

SCOPe Domain Coordinates for d1q4mb_:

Click to download the PDB-style file with coordinates for d1q4mb_.
(The format of our PDB-style files is described here.)

Timeline for d1q4mb_: