![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries) Uniprot P05979 32-584 |
![]() | Domain d1q4ga2: 1q4g A:32-73 [95790] Other proteins in same PDB: d1q4ga1, d1q4gb1 complexed with bfl, bog, gol, hem |
PDB Entry: 1q4g (more details), 2 Å
SCOPe Domain Sequences for d1q4ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d1q4ga2: